PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015817-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 494aa    MW: 55459.4 Da    PI: 6.4606
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015817-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.7e-123778345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      W ++E+ ll+++++++G g+W+ +a+++g ++   qc++++ 
    NNU_015817-RA 37 DWNADEEILLLEGIEMYGLGNWAEVAEHVG-TKNKAQCIDHYS 78
                     6*****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250249.7E-12314494IPR016827Transcriptional adaptor 2
PROSITE profilePS5129321.7043385IPR017884SANT domain
SuperFamilySSF466895.23E-123484IPR009057Homeodomain-like
SMARTSM007176.9E-113483IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-93680IPR009057Homeodomain-like
PfamPF002493.6E-113778IPR001005SANT/Myb domain
CDDcd001678.10E-113877No hitNo description
SuperFamilySSF466894.44E-18408488IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MGRSRGVPNS ADEDPGQRSK RKRVASSGEN LESATTDWNA DEEILLLEGI EMYGLGNWAE  60
VAEHVGTKNK AQCIDHYSTT YMNSPCFPLP DMSHVVGKNR KELLAMAKGH GEGKKGFPIL  120
GEQMMKEESP FSPSRVKLED LSKEAPADSG IGSSNTNPSS TGAVKKASNV TQVKESPDPI  180
KLEDSEVDRS VGGKKPKSSG DEGPSLSELS GYNPKRQEFD PEYDNDAEQS LAEMEFKDAD  240
TEAERELKLR VLHIYLKRLD ERKRRKDFIL ERNLLYPNPL EKDLSPEEKN IYHRYKVFMR  300
FLSKEEHEEL MKTVIDEHRI RKRIQDLQEA RAAGCHTSAD LDRYIEHKRK REAEESARRG  360
KEGPLVGPSG KVLQRTNRPK GEADSSPRGG VKGSLGLETG GKDLASTTLR QSAMDDWCIT  420
GLPGSDLLSE TDQRLCCELQ LFPSHYLKIQ EIMSVEIFSG NITKKSDAYR FFKVEPSKLD  480
RIYDVLAKKL IAQP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261266RKRRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270204.10.0PREDICTED: transcriptional adapter ADA2-like isoform X4
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A067KTX10.0A0A067KTX1_JATCU; Uncharacterized protein
STRINGVIT_00s0194g00130.t010.0(Vitis vinifera)